www.sidhhivinayakelectricmechanicalandfabricationwork.com - Detailed Indepth Information and Report for www.sidhhivinayakelectricmechanicalandfabricationwork.com server location, www.sidhhivinayakelectricmechanicalandfabricationwork.com website speed, www.sidhhivinayakelectricmechanicalandfabricationwork.com website DNS lookup, www.sidhhivinayakelectricmechanicalandfabricationwork.com Domain Details,www.sidhhivinayakelectricmechanicalandfabricationwork.com social account information, etc. Complete Analysis of www.sidhhivinayakelectricmechanicalandfabricationwork.com SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for sidhhivinayakelectricmechanicalandfabricationwork - www.sidhhivinayakelectricmechanicalandfabricationwork.com
Page URL : | http://www.sidhhivinayakelectricmechanicalandfabricationwork.com/ |
---|---|
Page Download Size : | 0.0000 Kb |
Page Load Time : | 0.0159 Sec |
Download Speed : | 0.0000 Mbps |
Leading Manufacturer & Supplier of Sewage Water Treatment Plant based in Maharashtra. SIDDHIVINAYAK ELECTRIC MECHANICAL AND FABRICATION offers best quality Sewage Water Treatment Plant, Waste Water Treatment Plant and more..During our test, www.sidhhivinayakelectricmechanicalandfabricationwork.com was downloaded in 0.0159 seconds. The homepage of the website is of 0.0000 Kb. The homepage was downloaded at the speed of 0.0000 Mbps, which is on the lower side.
www.sidhhivinayakelectricmechanicalandfabricationwork.com business details :
We could not found details of the business associated with the website www.sidhhivinayakelectricmechanicalandfabricationwork.com
Website Rank & Score to sidhhivinayakelectricmechanicalandfabricationwork.com by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.sidhhivinayakelectricmechanicalandfabricationwork.com. www.sidhhivinayakelectricmechanicalandfabricationwork.com ranks is not applicable. www.sidhhivinayakelectricmechanicalandfabricationwork.com is not a top rated website as per Alexa Ranking. The website www.sidhhivinayakelectricmechanicalandfabricationwork.com does not rank amongst top 1 million websites globally or in its country.
Global Alexa Rank | Not Applicable |
---|---|
Country Alexa Rank | Not Applicable |
Web Server Information - www.sidhhivinayakelectricmechanicalandfabricationwork.com
sidhhivinayakelectricmechanicalandfabricationwork.com is hosted on Server 35.200.229.130 in Google LLC Data Center. Approximate latitude and logitude of the IP 35.200.229.130 are 37.405990600586 and -122.07851409912 respectively. sidhhivinayakelectricmechanicalandfabricationwork.com is hosted in Mountain View, California, United States.
Hosted IP Address | 35.200.229.130 |
---|---|
Hosted Country | United States |
Location Latitude | 37.405990600586 |
Location Longitude | -122.07851409912 |
Server ISP | Google LLC |
Server Region | California |
Server City | Mountain View |
Page Title of www.sidhhivinayakelectricmechanicalandfabricationwork.com
Sewage Water Treatment Plant Price - Manufacturer & Supplier,Maharashtra
Meta Tags of www.sidhhivinayakelectricmechanicalandfabricationwork.com
Upon analysing the homepage of www.sidhhivinayakelectricmechanicalandfabricationwork.com, we found the following meta keywords - Sewage Water Treatment Plant Manufacturer, Sewage Water Treatment Plant Supplier, Sewage Water Treatment Plant in Maharashtra.
We could not find Meta Author, Meta Generator, Meta Viewport, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.sidhhivinayakelectricmechanicalandfabricationwork.com
Meta Keywords | Sewage Water Treatment Plant Manufacturer, Sewage Water Treatment Plant Supplier, Sewage Water Treatment Plant in Maharashtra |
---|---|
Meta Author | Not Applicable |
Meta Generator | Not Applicable |
Meta Viewport | Not Applicable |
Meta Framework | Not Applicable |
Meta Theme Color | Not Applicable |
Meta MS-App | Not Applicable |
Meta Format Detection | Not Applicable |
Social Accounts
www.sidhhivinayakelectricmechanicalandfabricationwork.com has a Facebook page link on its website. The Facebook link of www.sidhhivinayakelectricmechanicalandfabricationwork.com is https://www.facebook.com/tradeindia
www.sidhhivinayakelectricmechanicalandfabricationwork.com has a Lindedin link on its website. The LinkedIn URL of www.sidhhivinayakelectricmechanicalandfabricationwork.com is https://www.linkedin.com/company/tradeindia
We could not find Youtube URL, Instagram URL for www.sidhhivinayakelectricmechanicalandfabricationwork.com
Facebook Link |
---|
https://www.facebook.com/tradeindia |
Youtube Link |
Not Available |
Instagram Link |
Not Available |
Linkedin Link |
https://www.linkedin.com/company/tradeindia |
Contact Information - sidhhivinayakelectricmechanicalandfabricationwork.com
Contact Number |
---|
We could not find any contact number for sidhhivinayakelectricmechanicalandfabricationwork.com. To find contact number of sidhhivinayakelectricmechanicalandfabricationwork.com, we recommend you visit sidhhivinayakelectricmechanicalandfabricationwork.com and find it there. |
Email Address |
---|
We could not find any Email ID for sidhhivinayakelectricmechanicalandfabricationwork.com |
Domain TYPOS
Some common domain name typos of sidhhivinayakelectricmechanicalandfabricationwork.com are as follows:
Website Inpage Analysis
We didn't find any H3 Tags, H4 Tags, H5 Tags, H6 Tags, Audio Tags, Video Tags, Google Adsense on sidhhivinayakelectricmechanicalandfabricationwork.com, however, there are 1 H1 Tags, 4 H2 Tags, 9 Paragraph Tags, 1 Iframe Tags, 13 Image Tags, 153 Div Tags, and Google Analytics available.
H1 Heading | 1 |
---|---|
H3 Heading | Not Applicable |
H5 Heading | Not Applicable |
P Tag | 9 |
Total IFRAMEs | 1 |
Audio | Not Applicable |
Google Adsense | Not Applicable |
H2 Heading | 4 |
---|---|
H4 Heading | Not Applicable |
H6 Heading | Not Applicable |
Total Images | 13 |
Div Tag | 153 |
Video | Not Applicable |
Google Analytics | AVAILABLE |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.sidhhivinayakelectricmechanicalandfabricationwork.com
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
sidhhivinayakelectricmechanicalandfabricationwork.com | A | 300 | IP : 35.200.229.130 |
sidhhivinayakelectricmechanicalandfabricationwork.com | NS | 300 | Target : ns.tradeindia.com |
sidhhivinayakelectricmechanicalandfabricationwork.com | SOA | 38400 |
MNAME : server1.trade-india.com RNAME : sysadmin.tradeindia.com Serial : 2020011500 Refresh : 10800 Retry : 3600 Expire : 604800 Minimum TTL : 3600 |
sidhhivinayakelectricmechanicalandfabricationwork.com | MX | 300 | Target : mx.sidhhivinayakelectricmechanicalandfabricationwork.com.cust.a.hostedemail.com |
sidhhivinayakelectricmechanicalandfabricationwork.com | TXT | 300 | Text : v=spf1 include:_spf.hostedemail.com ~all |
sidhhivinayakelectricmechanicalandfabricationwork.com | TXT | 300 | Text : 2020012105063737ft1ahzg6tvzwno7acb1vtu6urv5hamstyy78vgrrftcww8oh |