www.sidhhivinayakelectricmechanicalandfabricationwork.com - Detailed Indepth Information and Report for www.sidhhivinayakelectricmechanicalandfabricationwork.com server location, www.sidhhivinayakelectricmechanicalandfabricationwork.com website speed, www.sidhhivinayakelectricmechanicalandfabricationwork.com website DNS lookup, www.sidhhivinayakelectricmechanicalandfabricationwork.com Domain Details,www.sidhhivinayakelectricmechanicalandfabricationwork.com social account information, etc. Complete Analysis of www.sidhhivinayakelectricmechanicalandfabricationwork.com SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for sidhhivinayakelectricmechanicalandfabricationwork - www.sidhhivinayakelectricmechanicalandfabricationwork.com

Page URL : http://www.sidhhivinayakelectricmechanicalandfabricationwork.com/
Page Download Size : 0.0000 Kb
Page Load Time : 0.0159 Sec
Download Speed : 0.0000 Mbps

Leading Manufacturer & Supplier of Sewage Water Treatment Plant based in Maharashtra. SIDDHIVINAYAK ELECTRIC MECHANICAL AND FABRICATION offers best quality Sewage Water Treatment Plant, Waste Water Treatment Plant and more..During our test, www.sidhhivinayakelectricmechanicalandfabricationwork.com was downloaded in 0.0159 seconds. The homepage of the website is of 0.0000 Kb. The homepage was downloaded at the speed of 0.0000 Mbps, which is on the lower side.

www.sidhhivinayakelectricmechanicalandfabricationwork.com business details :

We could not found details of the business associated with the website www.sidhhivinayakelectricmechanicalandfabricationwork.com

Website Rank & Score to sidhhivinayakelectricmechanicalandfabricationwork.com by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.sidhhivinayakelectricmechanicalandfabricationwork.com. www.sidhhivinayakelectricmechanicalandfabricationwork.com ranks is not applicable. www.sidhhivinayakelectricmechanicalandfabricationwork.com is not a top rated website as per Alexa Ranking. The website www.sidhhivinayakelectricmechanicalandfabricationwork.com does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.sidhhivinayakelectricmechanicalandfabricationwork.com

sidhhivinayakelectricmechanicalandfabricationwork.com is hosted on Server 35.200.229.130 in Google LLC Data Center. Approximate latitude and logitude of the IP 35.200.229.130 are 37.405990600586 and -122.07851409912 respectively. sidhhivinayakelectricmechanicalandfabricationwork.com is hosted in Mountain View, California, United States.

Hosted IP Address

35.200.229.130

Hosted Country

United States

Location Latitude

37.405990600586

Location Longitude

-122.07851409912

Server ISP

Google LLC

Server Region

California

Server City

Mountain View

Page Title of www.sidhhivinayakelectricmechanicalandfabricationwork.com

Sewage Water Treatment Plant Price - Manufacturer & Supplier,Maharashtra

Meta Tags of www.sidhhivinayakelectricmechanicalandfabricationwork.com

Upon analysing the homepage of www.sidhhivinayakelectricmechanicalandfabricationwork.com, we found the following meta keywords - Sewage Water Treatment Plant Manufacturer, Sewage Water Treatment Plant Supplier, Sewage Water Treatment Plant in Maharashtra.

We could not find Meta Author, Meta Generator, Meta Viewport, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.sidhhivinayakelectricmechanicalandfabricationwork.com

Meta Keywords

Sewage Water Treatment Plant Manufacturer, Sewage Water Treatment Plant Supplier, Sewage Water Treatment Plant in Maharashtra

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Not Applicable

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

www.sidhhivinayakelectricmechanicalandfabricationwork.com has a Facebook page link on its website. The Facebook link of www.sidhhivinayakelectricmechanicalandfabricationwork.com is https://www.facebook.com/tradeindia

www.sidhhivinayakelectricmechanicalandfabricationwork.com has a Lindedin link on its website. The LinkedIn URL of www.sidhhivinayakelectricmechanicalandfabricationwork.com is https://www.linkedin.com/company/tradeindia

We could not find Youtube URL, Instagram URL for www.sidhhivinayakelectricmechanicalandfabricationwork.com

Facebook Link
https://www.facebook.com/tradeindia
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
https://www.linkedin.com/company/tradeindia

Contact Information - sidhhivinayakelectricmechanicalandfabricationwork.com

Contact Number
We could not find any contact number for sidhhivinayakelectricmechanicalandfabricationwork.com. To find contact number of sidhhivinayakelectricmechanicalandfabricationwork.com, we recommend you visit sidhhivinayakelectricmechanicalandfabricationwork.com and find it there.
Email Address
We could not find any Email ID for sidhhivinayakelectricmechanicalandfabricationwork.com

Domain TYPOS

Some common domain name typos of sidhhivinayakelectricmechanicalandfabricationwork.com are as follows:

Website Inpage Analysis

We didn't find any H3 Tags, H4 Tags, H5 Tags, H6 Tags, Audio Tags, Video Tags, Google Adsense on sidhhivinayakelectricmechanicalandfabricationwork.com, however, there are 1 H1 Tags, 4 H2 Tags, 9 Paragraph Tags, 1 Iframe Tags, 13 Image Tags, 153 Div Tags, and Google Analytics available.

H1 Heading

1

H3 Heading

Not Applicable

H5 Heading

Not Applicable

P Tag

9

Total IFRAMEs

1

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

4

H4 Heading

Not Applicable

H6 Heading

Not Applicable

Total Images

13

Div Tag

153

Video

Not Applicable

Google Analytics

AVAILABLE

HTTP Header Analysis

Following is the HTTP Header Analyis of www.sidhhivinayakelectricmechanicalandfabricationwork.com

DNS Record Analysis

Host Type TTL Extra
sidhhivinayakelectricmechanicalandfabricationwork.com A 300 IP : 35.200.229.130
sidhhivinayakelectricmechanicalandfabricationwork.com NS 300 Target : ns.tradeindia.com
sidhhivinayakelectricmechanicalandfabricationwork.com SOA 38400 MNAME : server1.trade-india.com
RNAME : sysadmin.tradeindia.com
Serial : 2020011500
Refresh : 10800
Retry : 3600
Expire : 604800
Minimum TTL : 3600
sidhhivinayakelectricmechanicalandfabricationwork.com MX 300 Target : mx.sidhhivinayakelectricmechanicalandfabricationwork.com.cust.a.hostedemail.com
sidhhivinayakelectricmechanicalandfabricationwork.com TXT 300 Text : v=spf1 include:_spf.hostedemail.com ~all
sidhhivinayakelectricmechanicalandfabricationwork.com TXT 300 Text : 2020012105063737ft1ahzg6tvzwno7acb1vtu6urv5hamstyy78vgrrftcww8oh