www.saraswatishikshamahavidyalaya.co.in - Detailed Indepth Information and Report for www.saraswatishikshamahavidyalaya.co.in server location, www.saraswatishikshamahavidyalaya.co.in website speed, www.saraswatishikshamahavidyalaya.co.in website DNS lookup, www.saraswatishikshamahavidyalaya.co.in Domain Details,www.saraswatishikshamahavidyalaya.co.in social account information, etc. Complete Analysis of www.saraswatishikshamahavidyalaya.co.in SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for saraswatishikshamahavidyalaya - www.saraswatishikshamahavidyalaya.co.in

Page URL : http://www.saraswatishikshamahavidyalaya.co.in/
Page Download Size : 0.0000 Kb
Page Load Time : 0.0123 Sec
Download Speed : 0.0000 Mbps

During our test, www.saraswatishikshamahavidyalaya.co.in was downloaded in 0.0123 seconds. The homepage of the website is of 0.0000 Kb. The homepage was downloaded at the speed of 0.0000 Mbps, which is on the lower side.

www.saraswatishikshamahavidyalaya.co.in business details :

We could not found details of the business associated with the website www.saraswatishikshamahavidyalaya.co.in

Website Rank & Score to saraswatishikshamahavidyalaya.co.in by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.saraswatishikshamahavidyalaya.co.in. www.saraswatishikshamahavidyalaya.co.in ranks is not applicable. www.saraswatishikshamahavidyalaya.co.in is not a top rated website as per Alexa Ranking. The website www.saraswatishikshamahavidyalaya.co.in does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.saraswatishikshamahavidyalaya.co.in

saraswatishikshamahavidyalaya.co.in is hosted on Server 208.91.199.19 in PDR Data Center. Approximate latitude and logitude of the IP 208.91.199.19 are 30.267150878906 and -97.743057250977 respectively. saraswatishikshamahavidyalaya.co.in is hosted in Austin, Texas, United States.

Hosted IP Address

208.91.199.19

Hosted Country

United States

Location Latitude

30.267150878906

Location Longitude

-97.743057250977

Server ISP

PDR

Server Region

Texas

Server City

Austin

Page Title of www.saraswatishikshamahavidyalaya.co.in

SSMV Mandsaur

Meta Tags of www.saraswatishikshamahavidyalaya.co.in

Upon analysing the homepage of www.saraswatishikshamahavidyalaya.co.in, we found that no meta keywords were present.

Meta Viewport of www.saraswatishikshamahavidyalaya.co.in is Mobile Optimized.

We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.saraswatishikshamahavidyalaya.co.in

Meta Keywords

Not Applicable

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

www.saraswatishikshamahavidyalaya.co.in has a Facebook page link on its website. The Facebook link of www.saraswatishikshamahavidyalaya.co.in is https://www.facebook.com/profile.php

We could not find Youtube URL, Instagram URL, Lindedin URL for www.saraswatishikshamahavidyalaya.co.in

Facebook Link
https://www.facebook.com/profile.php
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - saraswatishikshamahavidyalaya.co.in

Contact Number
We have detected the Contact Number for saraswatishikshamahavidyalaya.co.in as follows:
9425107374
9425949486
7089049486
Email Address
We found the Email ID for saraswatishikshamahavidyalaya.co.in as follows.
[email protected]
[email protected]

Domain TYPOS

Some common domain name typos of saraswatishikshamahavidyalaya.co.in are as follows:

Website Inpage Analysis

We didn't find any H3 Tags, H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on saraswatishikshamahavidyalaya.co.in, however, there are 7 H1 Tags, 4 H2 Tags, 10 H4 Tags, 14 Paragraph Tags, 20 Image Tags, 140 Div Tags.

H1 Heading

7

H3 Heading

Not Applicable

H5 Heading

Not Applicable

P Tag

14

Total IFRAMEs

Not Applicable

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

4

H4 Heading

10

H6 Heading

Not Applicable

Total Images

20

Div Tag

140

Video

Not Applicable

Google Analytics

Not Applicable

HTTP Header Analysis

Following is the HTTP Header Analyis of www.saraswatishikshamahavidyalaya.co.in

DNS Record Analysis

Host Type TTL Extra
saraswatishikshamahavidyalaya.co.in A 14400 IP : 208.91.199.19
saraswatishikshamahavidyalaya.co.in NS 86400 Target : ns1.ibittech.com
saraswatishikshamahavidyalaya.co.in NS 86400 Target : ns2.ibittech.com
saraswatishikshamahavidyalaya.co.in SOA 86400 MNAME : ns1.ibittech.com
RNAME : keyurbhadada.gmail.com
Serial : 2021032101
Refresh : 3600
Retry : 7200
Expire : 1209600
Minimum TTL : 86400
saraswatishikshamahavidyalaya.co.in MX 14400 Target : saraswatishikshamahavidyalaya.co.in
saraswatishikshamahavidyalaya.co.in TXT 14400 Text : v=spf1 a mx include:webhostbox.net ~all