www.saraswatamahavidyalayaanantapur.in - Detailed Indepth Information and Report for www.saraswatamahavidyalayaanantapur.in server location, www.saraswatamahavidyalayaanantapur.in website speed, www.saraswatamahavidyalayaanantapur.in website DNS lookup, www.saraswatamahavidyalayaanantapur.in Domain Details,www.saraswatamahavidyalayaanantapur.in social account information, etc. Complete Analysis of www.saraswatamahavidyalayaanantapur.in SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for saraswatamahavidyalayaanantapur - www.saraswatamahavidyalayaanantapur.in
Page URL : | http://www.saraswatamahavidyalayaanantapur.in/ |
---|---|
Page Download Size : | 0.1660 Kb |
Page Load Time : | 0.0162 Sec |
Download Speed : | 0.0100 Mbps |
During our test, www.saraswatamahavidyalayaanantapur.in was downloaded in 0.0162 seconds. The homepage of the website is of 0.1660 Kb. The homepage was downloaded at the speed of 0.0100 Mbps, which is on the lower side.
www.saraswatamahavidyalayaanantapur.in business details :
We could not found details of the business associated with the website www.saraswatamahavidyalayaanantapur.in
Website Rank & Score to saraswatamahavidyalayaanantapur.in by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.saraswatamahavidyalayaanantapur.in. www.saraswatamahavidyalayaanantapur.in ranks is not applicable. www.saraswatamahavidyalayaanantapur.in is not a top rated website as per Alexa Ranking. The website www.saraswatamahavidyalayaanantapur.in does not rank amongst top 1 million websites globally or in its country.
Global Alexa Rank | Not Applicable |
---|---|
Country Alexa Rank | Not Applicable |
Web Server Information - www.saraswatamahavidyalayaanantapur.in
saraswatamahavidyalayaanantapur.in is hosted on Server 209.188.12.162 in Secured Servers LLC Data Center. Approximate latitude and logitude of the IP 209.188.12.162 are 33.448379516602 and -112.07404327393 respectively. saraswatamahavidyalayaanantapur.in is hosted in Phoenix, Arizona, United States.
Hosted IP Address | 209.188.12.162 |
---|---|
Hosted Country | United States |
Location Latitude | 33.448379516602 |
Location Longitude | -112.07404327393 |
Server ISP | Secured Servers LLC |
Server Region | Arizona |
Server City | Phoenix |
Page Title of www.saraswatamahavidyalayaanantapur.in
Welcome Saraswata Mohavidyalaya Anantapur,Soro,Balasore,Odisha.
Meta Tags of www.saraswatamahavidyalayaanantapur.in
Upon analysing the homepage of www.saraswatamahavidyalayaanantapur.in, we found that no meta keywords were present.
We could not find Meta Author, Meta Generator, Meta Viewport, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.saraswatamahavidyalayaanantapur.in
Meta Keywords | Not Applicable |
---|---|
Meta Author | Not Applicable |
Meta Generator | Not Applicable |
Meta Viewport | Not Applicable |
Meta Framework | Not Applicable |
Meta Theme Color | Not Applicable |
Meta MS-App | Not Applicable |
Meta Format Detection | Not Applicable |
Social Accounts
We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.saraswatamahavidyalayaanantapur.in
Facebook Link |
---|
Not Available |
Youtube Link |
Not Available |
Instagram Link |
Not Available |
Linkedin Link |
Not Available |
Contact Information - saraswatamahavidyalayaanantapur.in
Contact Number |
---|
We could not find any contact number for saraswatamahavidyalayaanantapur.in. To find contact number of saraswatamahavidyalayaanantapur.in, we recommend you visit saraswatamahavidyalayaanantapur.in and find it there. |
Email Address |
---|
We could not find any Email ID for saraswatamahavidyalayaanantapur.in |
Domain TYPOS
Some common domain name typos of saraswatamahavidyalayaanantapur.in are as follows:
Website Inpage Analysis
We didn't find any H4 Tags, H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on saraswatamahavidyalayaanantapur.in, however, there are 1 H1 Tags, 1 H2 Tags, 1 H3 Tags, 7 Paragraph Tags, 29 Image Tags, 46 Div Tags.
H1 Heading | 1 |
---|---|
H3 Heading | 1 |
H5 Heading | Not Applicable |
P Tag | 7 |
Total IFRAMEs | Not Applicable |
Audio | Not Applicable |
Google Adsense | Not Applicable |
H2 Heading | 1 |
---|---|
H4 Heading | Not Applicable |
H6 Heading | Not Applicable |
Total Images | 29 |
Div Tag | 46 |
Video | Not Applicable |
Google Analytics | Not Applicable |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.saraswatamahavidyalayaanantapur.in
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
saraswatamahavidyalayaanantapur.in | MX | 86400 | Target : mail.saraswatamahavidyalayaanantapur.in |