harikrishnaenterprises-safetyequipmentsupplier.business.site - Detailed Indepth Information and Report for harikrishnaenterprises-safetyequipmentsupplier.business.site server location, harikrishnaenterprises-safetyequipmentsupplier.business.site website speed, harikrishnaenterprises-safetyequipmentsupplier.business.site website DNS lookup, harikrishnaenterprises-safetyequipmentsupplier.business.site Domain Details,harikrishnaenterprises-safetyequipmentsupplier.business.site social account information, etc. Complete Analysis of harikrishnaenterprises-safetyequipmentsupplier.business.site SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for business - harikrishnaenterprises-safetyequipmentsupplier.business.site
Page URL : | https://harikrishnaenterprises-safetyequipmentsupplier.business.site/ |
---|---|
Page Download Size : | 1.5244 Kb |
Page Load Time : | 0.0116 Sec |
Download Speed : | 0.1283 Mbps |
During our test, harikrishnaenterprises-safetyequipmentsupplier.business.site was downloaded in 0.0116 seconds. The homepage of the website is of 1.5244 Kb. The homepage was downloaded at the speed of 0.1283 Mbps, which is on the lower side.
harikrishnaenterprises-safetyequipmentsupplier.business.site business details :
We could not found details of the business associated with the website harikrishnaenterprises-safetyequipmentsupplier.business.site
Website Rank & Score to business.site by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of harikrishnaenterprises-safetyequipmentsupplier.business.site. harikrishnaenterprises-safetyequipmentsupplier.business.site ranks is not applicable. harikrishnaenterprises-safetyequipmentsupplier.business.site is not a top rated website as per Alexa Ranking. The website harikrishnaenterprises-safetyequipmentsupplier.business.site does not rank amongst top 1 million websites globally or in its country.
Global Alexa Rank | Not Applicable |
---|---|
Country Alexa Rank | Not Applicable |
Web Server Information - harikrishnaenterprises-safetyequipmentsupplier.business.site
business.site is hosted on Server 216.239.32.29 in Google LLC Data Center. Approximate latitude and logitude of the IP 216.239.32.29 are 37.405990600586 and -122.07851409912 respectively. business.site is hosted in Mountain View, California, United States.
Hosted IP Address | 216.239.32.29 |
---|---|
Hosted Country | United States |
Location Latitude | 37.405990600586 |
Location Longitude | -122.07851409912 |
Server ISP | Google LLC |
Server Region | California |
Server City | Mountain View |
Page Title of harikrishnaenterprises-safetyequipmentsupplier.business.site
Harikrishna Enterprises - Safety Equipment Supplier in Rewari
Meta Tags of harikrishnaenterprises-safetyequipmentsupplier.business.site
Upon analysing the homepage of harikrishnaenterprises-safetyequipmentsupplier.business.site, we found that no meta keywords were present.
Meta Viewport of harikrishnaenterprises-safetyequipmentsupplier.business.site is Mobile Optimized.
Meta Format Detection of harikrishnaenterprises-safetyequipmentsupplier.business.site is .
We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App for harikrishnaenterprises-safetyequipmentsupplier.business.site
Meta Keywords | Not Applicable |
---|---|
Meta Author | Not Applicable |
Meta Generator | Not Applicable |
Meta Viewport | Mobile Optimized |
Meta Framework | Not Applicable |
Meta Theme Color | Not Applicable |
Meta MS-App | Not Applicable |
Meta Format Detection | telephone=no |
Social Accounts
We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for harikrishnaenterprises-safetyequipmentsupplier.business.site
Facebook Link |
---|
Not Available |
Youtube Link |
Not Available |
Instagram Link |
Not Available |
Linkedin Link |
Not Available |
Contact Information - business.site
Contact Number |
---|
We have detected the Contact Number for business.site as follows: |
7099014907 |
Email Address |
---|
We could not find any Email ID for business.site |
Domain TYPOS
Some common domain name typos of business.site are as follows:
Website Inpage Analysis
We didn't find any H4 Tags, H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense on business.site, however, there are 1 H1 Tags, 4 H2 Tags, 3 H3 Tags, 17 Paragraph Tags, 7 Image Tags, 92 Div Tags, and Google Analytics available.
H1 Heading | 1 |
---|---|
H3 Heading | 3 |
H5 Heading | Not Applicable |
P Tag | 17 |
Total IFRAMEs | Not Applicable |
Audio | Not Applicable |
Google Adsense | Not Applicable |
H2 Heading | 4 |
---|---|
H4 Heading | Not Applicable |
H6 Heading | Not Applicable |
Total Images | 7 |
Div Tag | 92 |
Video | Not Applicable |
Google Analytics | AVAILABLE |
HTTP Header Analysis
Following is the HTTP Header Analyis of harikrishnaenterprises-safetyequipmentsupplier.business.site
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
www3.l.google.com | A | 182 | IP : 142.250.185.174 |
harikrishnaenterprises-safetyequipmentsupplier.business.site | CNAME | 3600 | |
www3.l.google.com | AAAA | 65 |