harikrishnaenterprises-safetyequipmentsupplier.business.site - Detailed Indepth Information and Report for harikrishnaenterprises-safetyequipmentsupplier.business.site server location, harikrishnaenterprises-safetyequipmentsupplier.business.site website speed, harikrishnaenterprises-safetyequipmentsupplier.business.site website DNS lookup, harikrishnaenterprises-safetyequipmentsupplier.business.site Domain Details,harikrishnaenterprises-safetyequipmentsupplier.business.site social account information, etc. Complete Analysis of harikrishnaenterprises-safetyequipmentsupplier.business.site SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for business - harikrishnaenterprises-safetyequipmentsupplier.business.site

Page URL : https://harikrishnaenterprises-safetyequipmentsupplier.business.site/
Page Download Size : 1.5244 Kb
Page Load Time : 0.0116 Sec
Download Speed : 0.1283 Mbps

During our test, harikrishnaenterprises-safetyequipmentsupplier.business.site was downloaded in 0.0116 seconds. The homepage of the website is of 1.5244 Kb. The homepage was downloaded at the speed of 0.1283 Mbps, which is on the lower side.

harikrishnaenterprises-safetyequipmentsupplier.business.site business details :

We could not found details of the business associated with the website harikrishnaenterprises-safetyequipmentsupplier.business.site

Website Rank & Score to business.site by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of harikrishnaenterprises-safetyequipmentsupplier.business.site. harikrishnaenterprises-safetyequipmentsupplier.business.site ranks is not applicable. harikrishnaenterprises-safetyequipmentsupplier.business.site is not a top rated website as per Alexa Ranking. The website harikrishnaenterprises-safetyequipmentsupplier.business.site does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - harikrishnaenterprises-safetyequipmentsupplier.business.site

business.site is hosted on Server 216.239.32.29 in Google LLC Data Center. Approximate latitude and logitude of the IP 216.239.32.29 are 37.405990600586 and -122.07851409912 respectively. business.site is hosted in Mountain View, California, United States.

Hosted IP Address

216.239.32.29

Hosted Country

United States

Location Latitude

37.405990600586

Location Longitude

-122.07851409912

Server ISP

Google LLC

Server Region

California

Server City

Mountain View

Page Title of harikrishnaenterprises-safetyequipmentsupplier.business.site

Harikrishna Enterprises - Safety Equipment Supplier in Rewari

Meta Tags of harikrishnaenterprises-safetyequipmentsupplier.business.site

Upon analysing the homepage of harikrishnaenterprises-safetyequipmentsupplier.business.site, we found that no meta keywords were present.

Meta Viewport of harikrishnaenterprises-safetyequipmentsupplier.business.site is Mobile Optimized.

Meta Format Detection of harikrishnaenterprises-safetyequipmentsupplier.business.site is .

We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App for harikrishnaenterprises-safetyequipmentsupplier.business.site

Meta Keywords

Not Applicable

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

telephone=no

Social Accounts

We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for harikrishnaenterprises-safetyequipmentsupplier.business.site

Facebook Link
Not Available
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - business.site

Contact Number
We have detected the Contact Number for business.site as follows:
7099014907
Email Address
We could not find any Email ID for business.site

Domain TYPOS

Some common domain name typos of business.site are as follows:

Website Inpage Analysis

We didn't find any H4 Tags, H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense on business.site, however, there are 1 H1 Tags, 4 H2 Tags, 3 H3 Tags, 17 Paragraph Tags, 7 Image Tags, 92 Div Tags, and Google Analytics available.

H1 Heading

1

H3 Heading

3

H5 Heading

Not Applicable

P Tag

17

Total IFRAMEs

Not Applicable

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

4

H4 Heading

Not Applicable

H6 Heading

Not Applicable

Total Images

7

Div Tag

92

Video

Not Applicable

Google Analytics

AVAILABLE

HTTP Header Analysis

Following is the HTTP Header Analyis of harikrishnaenterprises-safetyequipmentsupplier.business.site

DNS Record Analysis

Host Type TTL Extra
www3.l.google.com A 182 IP : 142.250.185.174
harikrishnaenterprises-safetyequipmentsupplier.business.site CNAME 3600
www3.l.google.com AAAA 65