www.cleansweepchimneyservicesllc.com - Detailed Indepth Information and Report for www.cleansweepchimneyservicesllc.com server location, www.cleansweepchimneyservicesllc.com website speed, www.cleansweepchimneyservicesllc.com website DNS lookup, www.cleansweepchimneyservicesllc.com Domain Details,www.cleansweepchimneyservicesllc.com social account information, etc. Complete Analysis of www.cleansweepchimneyservicesllc.com SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for cleansweepchimneyservicesllc - www.cleansweepchimneyservicesllc.com

Page URL : https://www.cleansweepchimneyservicesllc.com/
Page Download Size : 14.1758 Kb
Page Load Time : 0.0137 Sec
Download Speed : 1.0105 Mbps

Count on Clean Sweep Chimney Services for all your chimney sweep needs, including fireplace and dryer vent cleaning, in York, Gettysburg, Carlisle PA and surrounding areas..During our test, www.cleansweepchimneyservicesllc.com was downloaded in 0.0137 seconds. The homepage of the website is of 14.1758 Kb. The homepage was downloaded at the speed of 1.0105 Mbps, which is on the lower side.

www.cleansweepchimneyservicesllc.com business details :

We could not found details of the business associated with the website www.cleansweepchimneyservicesllc.com

Website Rank & Score to cleansweepchimneyservicesllc.com by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.cleansweepchimneyservicesllc.com. www.cleansweepchimneyservicesllc.com ranks is not applicable. www.cleansweepchimneyservicesllc.com is not a top rated website as per Alexa Ranking. The website www.cleansweepchimneyservicesllc.com does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.cleansweepchimneyservicesllc.com

cleansweepchimneyservicesllc.com is hosted on Server 216.70.123.129 in Media Temple Inc. Data Center. Approximate latitude and logitude of the IP 216.70.123.129 are 34.017185211182 and -118.39282989502 respectively. cleansweepchimneyservicesllc.com is hosted in Culver City, California, United States.

Hosted IP Address

216.70.123.129

Hosted Country

United States

Location Latitude

34.017185211182

Location Longitude

-118.39282989502

Server ISP

Media Temple Inc.

Server Region

California

Server City

Culver City

Page Title of www.cleansweepchimneyservicesllc.com

Chimney Cleaning, Sweep | Hanover, York, Carlisle PA | Repairs | Clean Sweep Chimney Services, LLC

Meta Tags of www.cleansweepchimneyservicesllc.com

Upon analysing the homepage of www.cleansweepchimneyservicesllc.com, we found that no meta keywords were present.

Meta Viewport of www.cleansweepchimneyservicesllc.com is Mobile Optimized.

We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.cleansweepchimneyservicesllc.com

Meta Keywords

Not Applicable

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.cleansweepchimneyservicesllc.com

Facebook Link
Not Available
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - cleansweepchimneyservicesllc.com

Contact Number
We could not find any contact number for cleansweepchimneyservicesllc.com. To find contact number of cleansweepchimneyservicesllc.com, we recommend you visit cleansweepchimneyservicesllc.com and find it there.
Email Address
We found the Email ID for cleansweepchimneyservicesllc.com as follows.
[email protected]

Domain TYPOS

Some common domain name typos of cleansweepchimneyservicesllc.com are as follows:

Website Inpage Analysis

We didn't find any H4 Tags, H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense on cleansweepchimneyservicesllc.com, however, there are 1 H1 Tags, 5 H2 Tags, 7 H3 Tags, 13 Paragraph Tags, 17 Image Tags, 53 Div Tags, and Google Analytics available.

H1 Heading

1

H3 Heading

7

H5 Heading

Not Applicable

P Tag

13

Total IFRAMEs

Not Applicable

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

5

H4 Heading

Not Applicable

H6 Heading

Not Applicable

Total Images

17

Div Tag

53

Video

Not Applicable

Google Analytics

AVAILABLE

HTTP Header Analysis

Following is the HTTP Header Analyis of www.cleansweepchimneyservicesllc.com

DNS Record Analysis

Host Type TTL Extra
cleansweepchimneyservicesllc.com A 43200 IP : 216.70.123.129
cleansweepchimneyservicesllc.com NS 43200 Target : ns1.mediatemple.net
cleansweepchimneyservicesllc.com NS 43200 Target : ns2.mediatemple.net
cleansweepchimneyservicesllc.com SOA 43200 MNAME : ns1.mediatemple.net
RNAME : dnsadmin.mediatemple.net
Serial : 2020072901
Refresh : 10800
Retry : 3600
Expire : 1209600
Minimum TTL : 43200
cleansweepchimneyservicesllc.com MX 43200 Target : ASPMX.L.GOOGLE.com
cleansweepchimneyservicesllc.com MX 43200 Target : ALT3.ASPMX.L.GOOGLE.com
cleansweepchimneyservicesllc.com MX 43200 Target : ALT2.ASPMX.L.GOOGLE.com
cleansweepchimneyservicesllc.com MX 43200 Target : ALT1.ASPMX.L.GOOGLE.com
cleansweepchimneyservicesllc.com MX 43200 Target : ALT4.ASPMX.L.GOOGLE.com
cleansweepchimneyservicesllc.com TXT 43200 Text : lii028j11e1tqh22efois7js8k
cleansweepchimneyservicesllc.com TXT 43200 Text : notokenfound
cleansweepchimneyservicesllc.com TXT 43200 Text : v=spf1 a mx include:_spf.google.com ~all